PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0114s0030.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 594aa    MW: 65044.7 Da    PI: 5.3362
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0114s0030.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.4e-33172228259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+v+k+ver++ d++++ei+Y+++Hnh+
  Kalax.0114s0030.2.p 172 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEVRKQVERTH-DGQITEIVYKSNHNHP 228
                          7***************************************9.***************8 PP

2WRKY104.55.8e-33362420159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +d+k+v++tYeg+Hnhe
  Kalax.0114s0030.2.p 362 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPGCLVRKHVERAPDDNKCVVTTYEGKHNHE 420
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-29164230IPR003657WRKY domain
PROSITE profilePS5081124.398166230IPR003657WRKY domain
SuperFamilySSF1182906.15E-26168230IPR003657WRKY domain
SMARTSM007741.4E-36171229IPR003657WRKY domain
PfamPF031065.8E-26172228IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.3E-35347422IPR003657WRKY domain
PROSITE profilePS5081136.896357422IPR003657WRKY domain
SuperFamilySSF1182901.18E-28357422IPR003657WRKY domain
SMARTSM007746.0E-38362421IPR003657WRKY domain
PfamPF031065.2E-25363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MLLCCVVEWQ PSPTTGSYYS PPFNQDLSFL TNSMVAPTAA GGYCDSLPSF HGSEHPAGEL  60
NNLHYFKDLE TQDLDGGFLN LPSQQLPLEF ELPVLSNEFI ASASIRNDYI DVDFLSPADL  120
SNAHTTLPLS QPNDHTTSQR NDPMYIDGAA DHVMEEEKRA SSPRMGGMRT TEDGYNWRKY  180
GQKQVKGSEF PRSYYKCTHP NCEVRKQVER THDGQITEIV YKSNHNHPQP MPNRRLTPDS  240
AFAQNEMDAG EGCGGGTSRG KNEGLDRALS EPILTELSPT GREKRFGAFD SSEAAELASP  300
PHNHAAEDDE AVEENMADAN EVHNDATDLR RAEDCMVEPS MSSRGVREQK IVVEIETEVD  360
ILDDGYRWRK YGQKVVKGNP NPRSYYKCTT PGCLVRKHVE RAPDDNKCVV TTYEGKHNHE  420
VPAAKNSSNA SSNAGHLSSA HPVGQPSHMP LAGSAAMTTP AQAQFQPPPF ESKPYMGNGF  480
SAHSLPGNFG NDVSFGASSM YPMQYGSFGL AASYPNIQRA GLSISRSPIL DSAAANPMTL  540
HYGFDNHRGG GVIQTAHPGD ENDPPAEGQS RTRRMMSQLM TPDQNQTITA SRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-35172423878Probable WRKY transcription factor 4
2lex_A5e-35172423878Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.13e-75WRKY family protein